DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Pax3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_446162.1 Gene:Pax3 / 114502 RGDID:620431 Length:484 Species:Rattus norvegicus


Alignment Length:136 Identity:44/136 - (32%)
Similarity:63/136 - (46%) Gaps:34/136 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 KRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD---RRKLAARLNLTDAQVKVWFQNRRMKWRHT 353
            |||:..||..|:..|.:.||..|::..|   ||   |.:||.|..||:|:|:|||.|||.:||  
  Rat   216 KRKQRRSRTTFTAEQLEELERAFERTHY---PDIYTREELAQRAKLTEARVQVWFSNRRARWR-- 275

  Fly   354 RENLKSGQEKQPSA---------VPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQADED 409
                     ||..|         :|  ||...|:.|:   .|...|..:|...:|:   .||..|
  Rat   276 ---------KQAGANQLMAFNHLIP--GGFPPTAMPT---LPTYQLSETSYQPTSI---PQAVSD 323

  Fly   410 DNIEIN 415
            .:..::
  Rat   324 PSSTVH 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/55 (44%)
Pax3NP_446162.1 PAX 34..159 CDD:128645
MFAP1 164..>286 CDD:336570 32/83 (39%)
Homeobox 222..276 CDD:333795 26/67 (39%)
Pax7 347..391 CDD:289156
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.