DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Prrx2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001099209.1 Gene:Prrx2 / 113931 RGDID:1311471 Length:248 Species:Rattus norvegicus


Alignment Length:178 Identity:57/178 - (32%)
Similarity:86/178 - (48%) Gaps:37/178 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PPPHNSTTASAL--LAPLHSLTSLQLTQQQQRFLGKTP----QQLLDIAPTSPAAAAAATSQNG- 272
            |||.....|.|.  .:..|.|...::....:|..|..|    ::.....|:..::.:.|..|:| 
  Rat    19 PPPAPGDCAQARKNFSVSHLLDLEEVAAAGRRAAGPVPGPEAREGAAREPSGGSSGSEAAPQDGE 83

  Fly   273 --AHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD---RRKLAARL 332
              |.|||         :.:..|:|:..:|..|::.|.:.||..|::..|   ||   |.:||.|:
  Rat    84 CAAPGHG---------SATKRKKKQRRNRTTFNSSQLQALERVFERTHY---PDAFVREELARRV 136

  Fly   333 NLTDAQVKVWFQNRRMKWRH-------TREN--LKS-GQE---KQPSA 367
            ||::|:|:|||||||.|:|.       ||..  ||| |||   :||.|
  Rat   137 NLSEARVQVWFQNRRAKFRRNERAMLATRSASLLKSYGQEAAIEQPVA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/55 (45%)
Prrx2NP_001099209.1 Homeobox 104..156 CDD:395001 24/54 (44%)
COG5576 <110..214 CDD:227863 35/78 (45%)
OAR 222..238 CDD:397759
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.