DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP013157

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_003436884.1 Gene:AgaP_AGAP013157 / 11175794 VectorBaseID:AGAP013157 Length:447 Species:Anopheles gambiae


Alignment Length:387 Identity:85/387 - (21%)
Similarity:130/387 - (33%) Gaps:136/387 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ENLSTHMYGECEVNPTLAKCPDPVNVDHELPTKESCASTTIVSTSPTSATSTTKVKLSFSVDRLL 80
            |:|..:.|...||..:        ||:     |.||..:......|     ..|.|:|       
Mosquito    87 EHLEEYFYKPTEVERS--------NVE-----KRSCEKSCETIKPP-----AMKRKIS------- 126

  Fly    81 GSEPEESHRQSSSSPSTKSCCDGSILACCSFPH-CFSQANAESRRFGHATLPPTFTPTSSHTYPF 144
               .:|::.....||:.::............|| ..|..|..|||. .||               
Mosquito   127 ---EKETNDNEKDSPALRALLTNPAKKLKYNPHYAHSMTNESSRRI-EAT--------------- 172

  Fly   145 VGLDKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPTLATN-------ALLRFHQHQKQQHQQHHHH 202
            :|.:..|..|             .|::...|....|:.|       :||  ....||        
Mosquito   173 IGYNNGFLSP-------------AASDRIVPDIVPLSPNKTDDSIDSLL--DNSSKQ-------- 214

  Fly   203 QHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAA 267
                            :..|...:...|:||..:..|.:....  .||       |.||....:|
Mosquito   215 ----------------DIVTMQCVDYTLNSLRQITATPKYDGV--STP-------PLSPKNMESA 254

  Fly   268 TSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARL 332
            .|..|...|         ...|:.:.::|:||.     |...||.:|...:|:.:..|.::|:.|
Mosquito   255 ISSQGVENH---------PKESSKRTRQSYSRH-----QTIELEKEFHFNRYLNRRRRIEIASML 305

  Fly   333 NLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTP--SGDG-TPQEALD 391
            .||:.|:|:||||||||           .:|..||        ..:||  :.|| .||::|:
Mosquito   306 KLTERQIKIWFQNRRMK-----------AKKDNSA--------SANTPDLTYDGEIPQQSLE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
AgaP_AGAP013157XP_003436884.1 FTZ 46..249 CDD:281812 46/253 (18%)
Homeobox 271..324 CDD:278475 23/68 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.