DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP013373

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_003436924.1 Gene:AgaP_AGAP013373 / 11175540 VectorBaseID:AGAP013373 Length:216 Species:Anopheles gambiae


Alignment Length:126 Identity:36/126 - (28%)
Similarity:59/126 - (46%) Gaps:28/126 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 NGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTR 354
            |.:||   .|..:|.:|.:.||.:||:..|:....|.:||..|.||:.|:|.||||||.|::..:
Mosquito    17 NRERK---PRQAYSAMQLERLEDEFQRNIYLNVNKRFELAQCLGLTETQIKTWFQNRRTKFKKQQ 78

  Fly   355 ENLKSGQEKQPSAV--------PESGG-----------------VFKTSTPSGDGTPQEAL 390
            ::....:::|.:.:        |:.|.                 |.::|.....||.|.||
Mosquito    79 DSRNKREQRQQAQLIAQWLFQPPQLGSIPLDGQLQPLPRLAALPVHRSSLALAQGTLQSAL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 23/52 (44%)
AgaP_AGAP013373XP_003436924.1 Homeobox 22..75 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.