DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and LBX1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_006553.2 Gene:LBX1 / 10660 HGNCID:16960 Length:281 Species:Homo sapiens


Alignment Length:271 Identity:75/271 - (27%)
Similarity:97/271 - (35%) Gaps:84/271 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 HKPPPHNST------------------TASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPT 259
            |.|||.||.                  .:.:|....|.|.:..  :..|..|....:.||  :.|
Human    22 HLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAAD--KHAQGGLPLAGRALL--SQT 82

  Fly   260 SPAAA----AAATSQ-------NGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQ 313
            ||..|    |:.|.:       ..|.|..|....|....    .:||..||..|:|.|...||.:
Human    83 SPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQT----PKKRRKSRTAFTNHQIYELEKR 143

  Fly   314 FQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLK-----------SGQ------ 361
            |..|||::..||.::|.:|.||:|||..||||||.|.:...|.:|           |||      
Human   144 FLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVAL 208

  Fly   362 ---EKQPSAVPESGG------------VFKTSTPSGDG------------TPQEALDYSSDSCSS 399
               |:...|....||            |.....|...|            |.|.|   ||..||.
Human   209 AELEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPA---SSQDCSE 270

  Fly   400 VDLSEQADEDD 410
            .:..|:.|.||
Human   271 DEEDEEIDVDD 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/52 (52%)
LBX1NP_006553.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 6/12 (50%)
Homeobox 128..181 CDD:278475 27/52 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..281 15/69 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.