DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and CDX4

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_005184.1 Gene:CDX4 / 1046 HGNCID:1808 Length:284 Species:Homo sapiens


Alignment Length:210 Identity:55/210 - (26%)
Similarity:81/210 - (38%) Gaps:74/210 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 HKPP-------PHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAA------- 263
            :.||       |..|:|...:  |::.:||                        ||||       
Human    76 YSPPREDWSVYPGPSSTMGTV--PVNDVTS------------------------SPAAFCSTDYS 114

  Fly   264 ----AAAATSQNGAHGHGGGN----GQGNASAGSNGKRKRS---WS----------------RAV 301
                ....||.:...|..||:    ..|.|.|.|..:.:.|   |.                |.|
Human   115 NLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKTRTKEKYRVV 179

  Fly   302 FSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPS 366
            :::.||..||.:|...:|||...:.:||..|.|::.|||:||||||.|   .|:.:|    |:.|
Human   180 YTDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAK---ERKMIK----KKIS 237

  Fly   367 AVPESGGVFKTSTPS 381
            ....|||..::.:.|
Human   238 QFENSGGSVQSDSDS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/68 (35%)
CDX4NP_005184.1 Caudal_act 13..162 CDD:309740 23/111 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..155 9/34 (26%)
Homeobox 177..229 CDD:306543 24/54 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..259 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.