DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Hoxa1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_037207.2 Gene:Hoxa1 / 103690132 RGDID:11414885 Length:334 Species:Rattus norvegicus


Alignment Length:392 Identity:94/392 - (23%)
Similarity:137/392 - (34%) Gaps:137/392 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DHELPTKESCASTTIVSTSPTSATSTTKVKLSFSVDRLLG-------SEPEESHRQSSSSPSTKS 99
            ||.:.|.:|||         .||.|..      ..||.||       |.....|......|:|  
  Rat    31 DHGITTFQSCA---------VSANSCG------GDDRFLGGRGVQITSPHHHHHHHHHPQPAT-- 78

  Fly   100 CCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPGPYMDYKSVLRP 164
                           :..:......:.|::..|::...:            |..||       .|
  Rat    79 ---------------YQTSGNLGVSYSHSSCGPSYGAQN------------FSAPY-------GP 109

  Fly   165 TPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHH-------PKHLH----QQHKPPPH 218
            ..:......:..||..|.............||  |||||.:       |:::|    |:|:    
  Rat   110 YGLNQEADVSGGYPPCAPAVYSGNLSSPMVQH--HHHHQGYAGGTVGSPQYIHHSYGQEHQ---- 168

  Fly   219 NSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQ------------- 270
                :.||....:||:.|..:.|:              |..|||:..::.:|             
  Rat   169 ----SLALATYNNSLSPLHASHQE--------------ACRSPASETSSPAQTFDWMKVKRNPPK 215

  Fly   271 NGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLT 335
            .|..|..|..||.||            .|..|:..|...||.:|...||:|:..|.::||.|.|.
  Rat   216 TGKVGEYGYVGQPNA------------VRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLN 268

  Fly   336 DAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTS--TPSG-DGTPQEALDYSSDSC 397
            :.|||:||||||||           |:|:     |..|:...|  ||.| |...:|:.:.||.|.
  Rat   269 ETQVKIWFQNRRMK-----------QKKR-----EKEGLLPISPATPPGSDEKTEESSEKSSSSP 317

  Fly   398 SS 399
            |:
  Rat   318 SA 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/52 (48%)
Hoxa1NP_037207.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..82 4/37 (11%)
Interaction with OGT. /evidence=ECO:0000250|UniProtKB:P09022 74..202 32/187 (17%)
COG5576 175..>285 CDD:227863 42/146 (29%)
Antp-type hexapeptide 203..208 0/4 (0%)
Homeobox 232..284 CDD:278475 25/62 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..334 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.