DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Hoxa3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001300749.1 Gene:Hoxa3 / 103690130 RGDID:1561431 Length:444 Species:Rattus norvegicus


Alignment Length:327 Identity:74/327 - (22%)
Similarity:109/327 - (33%) Gaps:107/327 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LGSEPEESHRQSSSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPF 144
            ||::..|.||.:.|..|..|                :.|:.:|.....|.|.....|.|..  |.
  Rat    39 LGTDGVEYHRPACSLQSPAS----------------AGAHPKSHELSEACLRTLSGPPSQP--PG 85

  Fly   145 VGLDKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHL 209
            :|...|.|.|                ..|||..|                               
  Rat    86 LGDPPLPPPP----------------PQAAPPAP------------------------------- 103

  Fly   210 HQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAA------- 267
             |..:|||.......|...|..|:               :|.|..:..|| ||:.|.:       
  Rat   104 -QPPQPPPQPPAPTPAAPPPPSSV---------------SPPQSANSNPT-PASTAKSPLLNSPT 151

  Fly   268 ----------TSQNGAHGHGGGNGQGNASAGSN---GKRKRSWSRAVFSNLQRKGLEIQFQQQKY 319
                      .|:........|:..|.:.||..   |:.....:|..:::.|...||.:|...:|
  Rat   152 VGKQIFPWMKESRQNTKQKTSGSSSGESCAGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRY 216

  Fly   320 ITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRE-----NLKSGQEKQPSAVPESGGVFKTST 379
            :.:|.|.::|..||||:.|:|:||||||||::..::     ....||....|.||...|.:..|.
  Rat   217 LCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGKGMLTSSGGQSPSRSPVPPGAGGYLNSM 281

  Fly   380 PS 381
            .|
  Rat   282 HS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 23/52 (44%)
Hoxa3NP_001300749.1 COG5576 <182..309 CDD:227863 33/102 (32%)
Homeobox 196..249 CDD:395001 23/52 (44%)
DUF4074 379..442 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.