DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and gsc2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_017946465.2 Gene:gsc2 / 101734976 XenbaseID:XB-GENE-22064768 Length:181 Species:Xenopus tropicalis


Alignment Length:153 Identity:42/153 - (27%)
Similarity:67/153 - (43%) Gaps:21/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 SALLAPLHSLTSLQLTQQQQRFL---GKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNA 285
            |.|..|....|.:.:..|.:..|   |::|:.|| :..:.......|:|:.....|......|:|
 Frog    19 SILSLPSPEKTEMTIAMQHESELAQKGQSPKDLL-VVTSQDEIWVTASSRIHWPLHMVHANHGDA 82

  Fly   286 SAG-----------SNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD---RRKLAARLNLTD 336
            .|.           .:.:|:....|.:|:..|.:.||..|...:|   ||   |.:||.|:.|.:
 Frog    83 GAAVTVEPPTLLSLPHTQRRTRRHRTIFTEDQLQALEQTFHHNQY---PDVIAREQLAGRIQLKE 144

  Fly   337 AQVKVWFQNRRMKWRHTRENLKS 359
            .:|:|||:|||.|||..:....|
 Frog   145 ERVEVWFKNRRAKWRRQKRGAAS 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/55 (40%)
gsc2XP_017946465.2 Homeobox 109..160 CDD:395001 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.