DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and evx2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_002935724.3 Gene:evx2 / 100498260 XenbaseID:XB-GENE-852923 Length:502 Species:Xenopus tropicalis


Alignment Length:242 Identity:56/242 - (23%)
Similarity:88/242 - (36%) Gaps:90/242 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 PTYPTLATNALLRFHQHQKQQHQQHHHH------------------QHHPKHLHQ-------QHK 214
            ||....|.||:|        :..:|.||                  :||.|...:       .|.
 Frog   105 PTVSDPAGNAVL--------EALEHAHHAGRLSPRITSSSLHGAIGEHHSKGKFEIESLFGISHS 161

  Fly   215 PPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQ---------------------------Q 252
            ....|...:.|               .:.:.|.:.|:                           |
 Frog   162 TEESNGDISGA---------------DRGKKLSQYPEVSKEADMNSDVEVGCAGLRSPGSINGNQ 211

  Fly   253 LLDIAPTSPAAAAAATSQNGAHGHGGGNG---QGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQF 314
            |.:.:..|.::.|:.|..:...|.|..||   .|::|:.::..|:   .|..|:..|...||.:|
 Frog   212 LKESSKDSGSSVASTTGSSTPSGIGSLNGLNPVGSSSSAADQVRR---YRTAFTREQIGRLEKEF 273

  Fly   315 QQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMK---------WRH 352
            .::.|:::|.|.:|||.|||.:..:||||||||||         |.|
 Frog   274 YRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMSWPH 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/61 (41%)
evx2XP_002935724.3 Homeobox 258..311 CDD:395001 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.