DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and evx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_002933430.2 Gene:evx1 / 100496893 XenbaseID:XB-GENE-483664 Length:491 Species:Xenopus tropicalis


Alignment Length:304 Identity:73/304 - (24%)
Similarity:107/304 - (35%) Gaps:95/304 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 CSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPF----------------------------- 144
            ||.|...:...||::: ||        |.|:|.:..                             
 Frog    69 CSLPEPVAHRAAEAQQ-GH--------PLSAHLHSLAMEGRKEMLVFLEGGQLGSLVGKRMAHLS 124

  Fly   145 --VG------LDKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHH 201
              ||      .|||.|      :|.|.|   ||...|....|..:.....:.:..|..:......
 Frog   125 DAVGSPMPEPQDKLVP------RSCLSP---RAGPIAPRDRPEGSDVEATQANGQQGSRSPALRI 180

  Fly   202 HQHHPKHLHQ------QHKPPPHNSTTASALLAPL--------HSLTSLQLTQQQQRFLGKTPQQ 252
            ...||..|..      ||.    :|.|.|.....:        :|..|....||||...|:.   
 Frog   181 SSPHPPALSDSLSAKGQHS----SSDTESDFYEEIEVSCTPECNSAASDYQQQQQQHSAGQC--- 238

  Fly   253 LLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQ 317
                  :.|...:.....:.:.|..|.:|..::.||...:|.|:    .|:..|...||.:|.::
 Frog   239 ------SEPMGGSPINGSDSSKGGVGPHGSLSSCAGDQMRRYRT----AFTREQIARLEKEFYRE 293

  Fly   318 KYITKPDRRKLAARLNLTDAQVKVWFQNRRMK---------WRH 352
            .|:::|.|.:|||.|||.:..:||||||||||         |.|
 Frog   294 NYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMTWPH 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/61 (39%)
evx1XP_002933430.2 Homeobox 275..328 CDD:365835 25/56 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.