DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and nyap2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_002937141.3 Gene:nyap2 / 100496387 XenbaseID:XB-GENE-1012710 Length:716 Species:Xenopus tropicalis


Alignment Length:245 Identity:50/245 - (20%)
Similarity:78/245 - (31%) Gaps:105/245 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAASMEQSMPENLST-------HMYGECEVNPTLAKCPDPVNVDHEL--------PTKESCASTT 55
            |::...||.|.:.||       |.|.:|.     :..|.||::...|        |..||..:.:
 Frog   402 SSSGHSQSSPPHPSTMYRTQSPHGYPKCH-----SASPSPVSMGRSLTPLSLKRPPPYESVHTGS 461

  Fly    56 IVSTSPTSATSTTKVKLSFSVDRLLGSEPEESHRQSSSSPSTKSCCDGSILACCSFPHCFSQANA 120
            :..:||:...||.:            :.|:|....:||:.:..|                ||::.
 Frog   462 LSRSSPSVPHSTVR------------NSPQEGKSVNSSTSTYNS----------------SQSSL 498

  Fly   121 ESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPGPYMDYKSVLR---------------PTPIRAA 170
            .||           ||||    |...|..||...    :|:||               |..|:..
 Frog   499 RSR-----------TPTS----PLEELSNLFTSG----RSLLRRPSSGRRSKEPSEKPPDEIKVR 544

  Fly   171 EHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNS 220
            .|:....|.|           :.::...||            ..||..:|
 Frog   545 SHSTEPLPKL-----------ENKERVVHH------------SSPPSRDS 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475
nyap2XP_002937141.3 NYAP_N 51..421 CDD:406008 6/18 (33%)
NYAP_C 464..716 CDD:406017 34/178 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.