DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and ventx2.2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_002937178.3 Gene:ventx2.2 / 100494704 XenbaseID:XB-GENE-920515 Length:333 Species:Xenopus tropicalis


Alignment Length:248 Identity:61/248 - (24%)
Similarity:90/248 - (36%) Gaps:82/248 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 HQHHPKHLHQQHKPPPHNS-------------------TTASALLAPL--------HSLTSLQLT 239
            |:..|....|::.|.|..|                   ...||.::|.        .|.:||...
 Frog    28 HKEQPSKGDQRYSPYPSPSLPSWNSDVSPSSWNSQLSPVAGSAQVSPCPGSAQYSSDSESSLYSN 92

  Fly   240 QQQQRFLGK---TPQQ-----LL--DIAP-------TSPAAAAAATSQNGA--HGHGGGNGQG-- 283
            :.:..|..|   ||..     ||  |.|.       :.||.....||...|  .|:......|  
 Frog    93 EDEDLFCEKDLNTPSTPGDNGLLHKDTATHDYSGMVSVPANTPRTTSNEDAAKSGYSTSTDSGYE 157

  Fly   284 ---------------------NASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRK 327
                                 |.::...||..|. .|..|::.|...||..||:.:|:...:|||
 Frog   158 SEASRSSSTAPEGDATVSLSPNDTSDEEGKLGRR-LRTAFTSDQISTLEKTFQKHRYLGASERRK 221

  Fly   328 LAARLNLTDAQVKVWFQNRRMKWRHTRENLKS------------GQEKQPSAV 368
            |||:|.|::.|:|.||||||||::...::.:.            |..:||:.|
 Frog   222 LAAKLQLSEVQIKTWFQNRRMKYKREIQDGRPDSYHPAQFFGVYGYSQQPTPV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/52 (50%)
ventx2.2XP_002937178.3 Homeobox 193..246 CDD:395001 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.