DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and prrx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_004913839.1 Gene:prrx1 / 100494324 XenbaseID:XB-GENE-484663 Length:248 Species:Xenopus tropicalis


Alignment Length:245 Identity:64/245 - (26%)
Similarity:99/245 - (40%) Gaps:52/245 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 HQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAH 274
            |...:..|..|...|.:.|.|.:|      |.::.|   :...|||:........|.|...:|..
 Frog     8 HVLDRQGPLGSRLESPITASLDNL------QAKKNF---SVSHLLDLEEAGEMVGAQAEDGSGEA 63

  Fly   275 GH---------GGG------NGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD 324
            |.         .|.      |.|.||.  ...|||:..:|..|::.|.:.||..|::..|   ||
 Frog    64 GRSLLESPGLTSGSDTPQQENEQMNAE--QKKKRKQRRNRTTFNSSQLQALERVFERTHY---PD 123

  Fly   325 ---RRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPE-SGGVFKTSTPS---- 381
               |..||.|:|||:|:|:|||||||.|:|.....:.:  .|..|.:.. :|.|.....|.    
 Frog   124 AFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLA--NKNASLLKSYAGDVTAVEQPIVPRP 186

  Fly   382 ----------GDGTPQEALDYSSDSCSSVDLSE---QADEDDNIEINVVE 418
                      |..:|..|:...|.:|::.:.::   .|:...|:.:...|
 Frog   187 APRPNEYLSWGTASPYSAMATYSSTCANTNPAQGMNMANSIANLRLKAKE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/55 (47%)
prrx1XP_004913839.1 Homeobox 102..154 CDD:365835 25/54 (46%)
OAR 221..238 CDD:367680 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.