DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and nobox

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_031761569.1 Gene:nobox / 100494031 XenbaseID:XB-GENE-22068768 Length:652 Species:Xenopus tropicalis


Alignment Length:210 Identity:56/210 - (26%)
Similarity:74/210 - (35%) Gaps:66/210 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 GKTPQQLLDIAPTSPAAAAAATSQN-----GAHGHGGGNGQGNASAGS---NGKRKRSWSRAVFS 303
            |..||.    ||....:|..|.|..     ...||||...:|...|.:   .|...|..||.::|
 Frog   207 GNFPQS----APLPRRSARCAASCRLPTFIYDTGHGGDRQRGKCPADAPEEPGPPCRKKSRTLYS 267

  Fly   304 NLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEK----- 363
            ..|.:.||..|.:..|.....||::|..:.:|..::.|||||||.|||...:....|..|     
 Frog   268 MDQLQELERLFAEDHYPDSEKRREIAEIIGVTPQRIMVWFQNRRAKWRKVEKTSIKGPRKPLSAA 332

  Fly   364 -------------------QPSAV---------------PESGGVFK----------TSTPSGDG 384
                               :|.||               |..|||..          .::.|.||
 Frog   333 GMSRPETAVLTVSSSVALSRPEAVSLSVTSGFHTYGSAFPPVGGVRNGFSMVPGSALPTSQSSDG 397

  Fly   385 TPQEALDYSSDSCSS 399
            :.|.     |.||||
 Frog   398 SSQH-----SASCSS 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 20/52 (38%)
noboxXP_031761569.1 COG5576 <252..364 CDD:227863 29/111 (26%)
Homeobox 262..316 CDD:395001 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.