DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and crybb2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001238879.2 Gene:crybb2 / 100493744 XenbaseID:XB-GENE-5866500 Length:204 Species:Xenopus tropicalis


Alignment Length:141 Identity:31/141 - (21%)
Similarity:48/141 - (34%) Gaps:48/141 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SPSTKSCCDGSILACCSFPHCFSQANAESRRFGH------ATLPPT-FTPTSS---HTYPFVGLD 148
            :|:||...:..|:       .|.|.|.:.|  .|      ::|..| .....|   |:.|:||.|
 Frog     7 TPATKQQQNAKIV-------IFEQENFQGR--SHELNGACSSLKETGMEKVGSVLVHSGPWVGYD 62

  Fly   149 K--------LF-PGPY-----------MDYKSVLRPTPIRAAEHAAPTYPT---------LATNA 184
            :        :| .|.|           .|..|.:||....:.||....|..         :..:.
 Frog    63 QQNCKGEQFVFEKGEYPRWDSWTNNRRTDSISSMRPIKNDSQEHKIVLYENPNFSGKKIEIIDDD 127

  Fly   185 LLRFHQHQKQQ 195
            :..||.|..|:
 Frog   128 VPSFHAHGYQE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475
crybb2NP_001238879.2 XTALbg 17..99 CDD:214583 20/90 (22%)
Crystall 107..189 CDD:394987 5/32 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.