powered by:
Protein Alignment H2.0 and LOC100493706
DIOPT Version :9
Sequence 1: | NP_523488.2 |
Gene: | H2.0 / 33841 |
FlyBaseID: | FBgn0001170 |
Length: | 418 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002945549.1 |
Gene: | LOC100493706 / 100493706 |
-ID: | - |
Length: | 130 |
Species: | Xenopus tropicalis |
Alignment Length: | 37 |
Identity: | 11/37 - (29%) |
Similarity: | 14/37 - (37%) |
Gaps: | 7/37 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 280 NGQGNASAGSNGKRKRSWSRAVFS-------NLQRKG 309
:|:|.....:..|.|...|||... .|.|||
Frog 2 SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKG 38
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.