DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and alx4

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_004913406.1 Gene:alx4 / 100493396 XenbaseID:XB-GENE-853003 Length:376 Species:Xenopus tropicalis


Alignment Length:231 Identity:62/231 - (26%)
Similarity:96/231 - (41%) Gaps:45/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 QHQQHH-HHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAP 258
            ::|.|| .||....||:.|..|....|.:.....:|...|  :....::......:..|.:|   
 Frog    86 KYQAHHPSHQQQQSHLYMQSTPCKSPSDSLKVQDSPGDPL--IPCYAKESALTPNSDHQGMD--- 145

  Fly   259 TSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKP 323
             |....:..|:..|:...|.|:...:.:...:.|.|:..:|..|::.|.:.||..||:..|   |
 Frog   146 -SGYITSKETAGKGSQDRGSGDLPMDKTESESNKGKKRRNRTTFTSYQLEELEKVFQKTHY---P 206

  Fly   324 D---RRKLAARLNLTDAQVKVWFQNRRMKWR---------HTRENLKSGQE-------------K 363
            |   |.:||.|.:||:|:|:|||||||.|||         ..|.:..|..|             :
 Frog   207 DVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSSAYELPLLTRAENYAQIQ 271

  Fly   364 QPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSS 399
            .||.:..:||          |:|..|.....|:.||
 Frog   272 NPSWIGNNGG----------GSPVPACVVPCDTVSS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/55 (47%)
alx4XP_004913406.1 COG5576 120..266 CDD:227863 42/154 (27%)
Homeobox 185..238 CDD:365835 27/55 (49%)
OAR 352..370 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.