DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and nkx1-1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_002936812.1 Gene:nkx1-1 / 100493120 XenbaseID:XB-GENE-488879 Length:408 Species:Xenopus tropicalis


Alignment Length:329 Identity:84/329 - (25%)
Similarity:118/329 - (35%) Gaps:122/329 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PHCFSQANAESRRFGHATLPPTFTPTSSH-TYPFVGLDKLFP-----------GPYM---DYKSV 161
            |:|.:.|..||  .|.|       |.:.| |..|..||.|.|           |.|.   ||   
 Frog    62 PNCNAPAGPES--LGAA-------PLAVHRTTSFSVLDILDPNKFNSKQRHCSGAYKPPGDY--- 114

  Fly   162 LRPTPIRAAEHAAPTYPTLAT--NALLRFHQHQKQQHQ---QHHHHQHHPKHLHQQHKPPPHNST 221
                .:|..|.|..  |.:||  .|.|..::..|:..:   :...:||......|..:..|    
 Frog   115 ----ILRGEEKAEG--PDIATGQKAFLEEYESCKKSTEVIKEEGLYQHSATEDCQTQEFSP---- 169

  Fly   222 TASALLAPLHSLTSLQLTQQQQRFLGK-----TPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNG 281
                  :|...|...:..::.:....:     ||..|.:..|                  |.|||
 Frog   170 ------SPGSDLEEEEDEEEDEEICSEESSNSTPSGLAERDP------------------GAGNG 210

  Fly   282 QG------NASAGSN-----------------GKRKRSWS----------RAVFSNLQRKGLEIQ 313
            ||      .|.||||                 .||||:.|          |..|:..|...||.:
 Frog   211 QGEDALNTGAPAGSNQQQPTGKNQQQQNQHGKPKRKRTGSDSKSGKPRRARTAFTYEQLVALENK 275

  Fly   314 FQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTS 378
            |:..:|::..:|..||..|:||:.|||:||||||.||:          ::.|.|        .||
 Frog   276 FKSTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWK----------KQNPGA--------DTS 322

  Fly   379 TPSG 382
            .|:|
 Frog   323 APTG 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/62 (39%)
nkx1-1XP_002936812.1 Homeobox 261..314 CDD:365835 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.