Sequence 1: | NP_523488.2 | Gene: | H2.0 / 33841 | FlyBaseID: | FBgn0001170 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001305673.1 | Gene: | uncx / 100492016 | XenbaseID: | XB-GENE-920201 | Length: | 483 | Species: | Xenopus tropicalis |
Alignment Length: | 225 | Identity: | 63/225 - (28%) |
---|---|---|---|
Similarity: | 81/225 - (36%) | Gaps: | 90/225 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 262 AAAAAATSQNGAHGHGGGNGQGNAS-----------AGSNG--------------------KRKR 295
Fly 296 SWSRAVFSNLQRKGLEIQFQQQKYITKPD---RRKLAARLNLTDAQVKVWFQNRRMKWRHTRENL 357
Fly 358 KSG-------------------------------------QEKQ----PSAVPESGGVFKTSTPS 381
Fly 382 GD---GTPQEALDYSSDSCSSVDLSEQADE 408 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
H2.0 | NP_523488.2 | Homeobox | 298..351 | CDD:278475 | 24/55 (44%) |
uncx | NP_001305673.1 | homeobox domain | 101..160 | 28/64 (44%) | |
Homeobox | 104..158 | CDD:365835 | 26/57 (46%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |