DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and uncx

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001305673.1 Gene:uncx / 100492016 XenbaseID:XB-GENE-920201 Length:483 Species:Xenopus tropicalis


Alignment Length:225 Identity:63/225 - (28%)
Similarity:81/225 - (36%) Gaps:90/225 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 AAAAAATSQNGAHGHGGGNGQGNAS-----------AGSNG--------------------KRKR 295
            ||||...|.:|..     ||...||           .|.||                    ||:|
 Frog    44 AAAAVPFSIDGLL-----NGSCTASVINPTPLLPSGCGLNGDSQQYKLSDSIDPDKESPGCKRRR 103

  Fly   296 SWSRAVFSNLQRKGLEIQFQQQKYITKPD---RRKLAARLNLTDAQVKVWFQNRRMKWRHTRENL 357
              :|..|:..|.:.||..|.:..|   ||   |..||.||:|.:::|:|||||||.||| .:||.
 Frog   104 --TRTNFTGWQLEELEKAFNESHY---PDVFMREALALRLDLVESRVQVWFQNRRAKWR-KKENT 162

  Fly   358 KSG-------------------------------------QEKQ----PSAVPESGGVFKTSTPS 381
            |.|                                     |||:    .:.:..|.|.....|||
 Frog   163 KKGPGRPAHNSHPTTCSGEPMDPEEIARKELEKMEKKKRKQEKKMLRNQNRLQHSPGDMSLHTPS 227

  Fly   382 GD---GTPQEALDYSSDSCSSVDLSEQADE 408
            .|   |..|. ||.||...|..|:.:...:
 Frog   228 SDSDSGLSQN-LDSSSLESSHPDMGQSRSQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/55 (44%)
uncxNP_001305673.1 homeobox domain 101..160 28/64 (44%)
Homeobox 104..158 CDD:365835 26/57 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.