DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and barx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_004914882.1 Gene:barx1 / 100491751 XenbaseID:XB-GENE-919916 Length:253 Species:Xenopus tropicalis


Alignment Length:239 Identity:71/239 - (29%)
Similarity:105/239 - (43%) Gaps:51/239 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 HQQHHHHQHHPKHLHQQHKPPPHNSTT-------ASALLA--PLHSLTSLQLTQQQQRFLGKTPQ 251
            |:.|.:.....:.:...|:.|..:...       ..|||:  |.|:  .|.|.:.:|..:.|.|.
 Frog    20 HRSHRYRSFMIEEILTDHQDPKASPPAGELLKFGVQALLSARPYHN--HLALLKAEQASVFKFPL 82

  Fly   252 QLLDI----APTSPAAAAAATSQNGAHG---------HGGGNGQGNAS--AGSNGKRKRSWSRAV 301
            ..|..    :|.|.|..||.:...|..|         |..|..:.:.|  .||..|:.|. ||.|
 Frog    83 SPLSCPALGSPISSALLAAGSGLQGGPGTPHHLPLELHLRGKLESSVSEQGGSKAKKGRR-SRTV 146

  Fly   302 FSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPS 366
            |:.||..|||.:|::|||::.|||..||..|.|:..|||.|:|||||||:..:            
 Frog   147 FTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIQ------------ 199

  Fly   367 AVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQADEDD 410
             |.:.||:...:.|.  |.|::         :|:..|||..|.:
 Frog   200 -VLQGGGLESPTKPK--GRPKK---------NSIPSSEQLTEQE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 30/52 (58%)
barx1XP_004914882.1 Homeobox 143..197 CDD:365835 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.