DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and barhl1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_004916717.1 Gene:barhl1 / 100491447 XenbaseID:XB-GENE-853661 Length:327 Species:Xenopus tropicalis


Alignment Length:167 Identity:50/167 - (29%)
Similarity:68/167 - (40%) Gaps:41/167 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 ALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDI-APTSPAAAAAATSQNGAHGH------------ 276
            ||....|....:||:...|.....:...:.|| |...|.|..|..|.||...|            
 Frog    69 ALAMESHLQPGVQLSAPSQSRTVTSSFLIRDILADCKPLATCAPYSSNGQPTHDLAHCLASKAAD 133

  Fly   277 --------------------GGGNGQGNASAGSNG-------KRKRSWSRAVFSNLQRKGLEIQF 314
                                |....:|:....|:.       |:.|. :|..|::.|...||..|
 Frog   134 DFRDKLDKSSSSTSSESEYKGKVKEEGDREISSSRDSPPVRLKKPRK-ARTAFTDHQLAQLERSF 197

  Fly   315 QQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWR 351
            ::|||::..||.:|||.|||||.|||.|:||||.||:
 Frog   198 ERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 28/52 (54%)
barhl1XP_004916717.1 Homeobox 182..235 CDD:365835 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.