DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and LOC100489067

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_002940137.1 Gene:LOC100489067 / 100489067 -ID:- Length:165 Species:Xenopus tropicalis


Alignment Length:123 Identity:23/123 - (18%)
Similarity:43/123 - (34%) Gaps:36/123 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 LEIQFQQQKYITKPDRRKLAARLNLTDA------------QVKVWFQNRRMKWRHTRENLKSGQE 362
            |.:..:|::..::.|.|..|.::|:...            .:...|:|..:...||         
 Frog    14 LMLAVKQRREPSEWDYRSEAEKVNMRGCANLTTVLDNWKFAIMTQFRNLLLYDHHT--------- 69

  Fly   363 KQPSAVPESGGVFKTSTPSGDGTPQEALD--YSSDSCSSVDLSEQADEDDNIEINVVE 418
                .:|:.|.:...|         ||||  |...:.....|.|.:.:.:.:|..|.|
 Frog    70 ----VLPDYGRIKSLS---------EALDDLYKEFNALKERLGELSTKFEGVEAFVDE 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 8/52 (15%)
LOC100489067XP_002940137.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165177144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.