DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and hlx

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_004914850.1 Gene:hlx / 100488508 XenbaseID:XB-GENE-483226 Length:397 Species:Xenopus tropicalis


Alignment Length:381 Identity:120/381 - (31%)
Similarity:155/381 - (40%) Gaps:113/381 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 CCDGSILACCSFP---------HCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPGPY 155
            |..|:......||         .|.    |:....|....||   .:|:.|...||:  :.|..|
 Frog    22 CTSGAGSGAAGFPALDTGKKPSFCI----ADILHGGDPESPP---GSSALTAASVGV--IHPAQY 77

  Fly   156 MDYKSVLRPTPI---RAAEHAAPTYP--------TLATNALLRFHQHQKQQHQQHHHHQHHPKHL 209
            ....|..||||:   .:..|.....|        :|.||...|...|:..|              
 Frog    78 QPAGSPFRPTPVTPESSFHHRLSPLPPYQPHRAVSLCTNNSSRARMHKSTQ-------------- 128

  Fly   210 HQQHKPPPHN-------STTASALLAP-------LHSLTSLQLTQQQQRFLGKTPQQLLD--IAP 258
                 |.|.:       ....||...|       |..||||....||....|:..|....  .||
 Frog   129 -----PAPCSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSLISAGQQSGLPGQHMQSTAGHFFAP 188

  Fly   259 TSPAAAAAATSQNGAHGHGGGNGQGNASA----------GSNG-------------------KRK 294
            ..|...|::..       |..||...:|.          ||..                   |||
 Frog   189 LEPLGEASSLL-------GQLNGSQRSSVQQFQDTFPGDGSRKLYMWGPYAVLTKDTMPQTYKRK 246

  Fly   295 RSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRE-NLK 358
            |||||||||||||||||.:|:.|||:|||||::|||.|.|||||||||||||||||||::| ..:
 Frog   247 RSWSRAVFSNLQRKGLEKRFEVQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQ 311

  Fly   359 SGQEKQPSAVPESGG-----VFKTSTP-SGDGTPQEALDYSSDSCSSVDLSEQADE 408
            ..:||:.:..||:.|     :.::|:| ..:|..:     ||| |.|:|:.....|
 Frog   312 KDKEKEEAEKPEAPGSGEVQMDRSSSPYRSEGESE-----SSD-CESLDMMPSDSE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 43/52 (83%)
hlxXP_004914850.1 Homeobox 250..304 CDD:365835 44/53 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I7001
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009017
OrthoInspector 1 1.000 - - oto103702
Panther 1 1.100 - - LDO PTHR46808
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7075
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.040

Return to query results.
Submit another query.