DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and arx

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_002933659.1 Gene:arx / 100486727 XenbaseID:XB-GENE-483940 Length:536 Species:Xenopus tropicalis


Alignment Length:222 Identity:70/222 - (31%)
Similarity:93/222 - (41%) Gaps:78/222 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 QKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAP-----LHSLTSLQLTQQQQRFLGKTPQ 251
            |:|||.|....|      .||.:|||...|.|.  |:|     |||..:                
 Frog   235 QEQQHPQFQSQQ------SQQQQPPPGCGTDAE--LSPKEELMLHSSDA---------------- 275

  Fly   252 QLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNA--SAGSNG-----KRKRSWSRAVFSNLQRKG 309
                                     .|.:|:.:.  ||||:.     |||:...|..|::.|.:.
 Frog   276 -------------------------DGKDGEDSVCLSAGSDSEEGMLKRKQRRYRTTFTSYQLEE 315

  Fly   310 LEIQFQQQKYITKPD---RRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPES 371
            ||..||:..|   ||   |.:||.||:||:|:|:|||||||.||| .||  |:|.:.....:|..
 Frog   316 LERAFQKTHY---PDVFTREELAMRLDLTEARVQVWFQNRRAKWR-KRE--KAGAQTHAPGLPFP 374

  Fly   372 GGVFKTSTPSG---DGTP----QEALD 391
            |.: ..|.|.|   |.:|    ..|||
 Frog   375 GPL-SASHPLGPYLDASPFPPHHPALD 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/55 (49%)
arxXP_002933659.1 Homeobox 305..358 CDD:365835 29/56 (52%)
OAR 500..518 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.