DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and tm9sf1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_002939067.1 Gene:tm9sf1 / 100486536 XenbaseID:XB-GENE-992446 Length:589 Species:Xenopus tropicalis


Alignment Length:89 Identity:17/89 - (19%)
Similarity:34/89 - (38%) Gaps:15/89 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 VLRPTPIRAAEHAAPTYPTLA-TNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTAS 224
            ::.|:|........|..|.:. .|.:..:|     ..|:.:|:...|....:|.:   |.|.|..
 Frog    14 LVAPSPATGDNRYKPGDPVMMYVNKVGPYH-----NPQETYHYYQLPVCAPEQIR---HKSLTLG 70

  Fly   225 ALL------APLHSLTSLQLTQQQ 242
            .:|      ..::.:|..|..::|
 Frog    71 EVLDGDRMAESMYRITFRQNVERQ 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475
tm9sf1XP_002939067.1 EMP70 48..546 CDD:281048 10/50 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.