DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and pax9

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_002935394.1 Gene:pax9 / 100485934 XenbaseID:XB-GENE-482238 Length:360 Species:Xenopus tropicalis


Alignment Length:249 Identity:47/249 - (18%)
Similarity:73/249 - (29%) Gaps:119/249 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 QQHHH--HQHHP--------KHLHQQHKP---------PPHNSTTASALLAP-----LHSLTSL- 236
            ||:|:  |:.||        .||:....|         ||...:....:..|     .||:|.: 
 Frog   136 QQNHYESHKQHPAAASALPYNHLYSYPSPIAAGAKVPTPPGMPSIPGTMGMPRTWPSSHSVTDIL 200

  Fly   237 ---QLTQQQQRFLGKTPQQLLDIAPTSP---------AAAAAATSQNGAHGHGGGNGQGNASAGS 289
               .:|.|              ::.|||         ::.:..|.|:..|               
 Frog   201 GIRSITDQ--------------VSDTSPYPSPKLEEWSSLSRNTFQSAQH--------------- 236

  Fly   290 NGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTR 354
                       |.:.|::..||   |:.||      .:.|:.|......|..             
 Frog   237 -----------VLNGLEKSSLE---QEVKY------SQSASGLPAVSGFVAA------------- 268

  Fly   355 ENLKSGQEKQPSAVPESGGV-FKTSTPSG----------DGTPQEALDYSSDSC 397
                ||....|:..|.|..: :.|:.|:|          .|||     .|..||
 Frog   269 ----SGMTPYPTTAPVSPYMAYSTAAPTGYVTGHGWQHTGGTP-----LSPHSC 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 10/52 (19%)
pax9XP_002935394.1 PAX 6..131 CDD:238076
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.