DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and gbx2.1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_002932046.1 Gene:gbx2.1 / 100485559 XenbaseID:XB-GENE-855771 Length:340 Species:Xenopus tropicalis


Alignment Length:376 Identity:75/376 - (19%)
Similarity:114/376 - (30%) Gaps:160/376 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SFSVDRLLGSEPEESHRQSSSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPT 137
            :||:|.|:||.|:.|                                           |..|..|
 Frog    21 AFSIDSLIGSPPQPS-------------------------------------------PGHFVYT 42

  Fly   138 SSHTYPFVGLDKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHH 202
            .   ||.          :|.|:.|:.|.|       .|..|:|:...|      |......|.||
 Frog    43 G---YPM----------FMPYRPVVLPPP-------PPPPPSLSQATL------QPTLPSAHPHH 81

  Fly   203 QHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLT--------QQQQRFLGKTPQQLLD---- 255
            |           .|...|...|:|...:...::|..|        .|.|....|...|.|.    
 Frog    82 Q-----------IPSLPSGFCSSLAQGMALTSTLMATLPGGFSASAQHQEAARKFGAQSLQGAFE 135

  Fly   256 ----------------------IAPTSPAAAA------AATSQNGAHGHGGG------------- 279
                                  :.|.|.:..:      ....::|....|.|             
 Frog   136 KSDGGQSDGEDGNKTYITKEGTLLPFSASEVSLGPVRGQGKEESGKEAEGKGKEDSYLMDSDLDY 200

  Fly   280 -------------------------NGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKY 319
                                     |...|::..|.||.:|  .|..|::.|...||.:|..:||
 Frog   201 SSDDNISCQTAHKEDDTPEESPPNSNPSNNSNTSSTGKNRR--RRTAFTSEQLLELEKEFHCKKY 263

  Fly   320 ITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPE 370
            ::..:|.::|..|.|::.|||:||||||.||:..:....:.:..:||..|:
 Frog   264 LSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNANSKTGEPSRNPK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
gbx2.1XP_002932046.1 Homeobox 242..296 CDD:365835 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.