DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and LOC100361016

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_008771600.2 Gene:LOC100361016 / 100361016 RGDID:2320944 Length:335 Species:Rattus norvegicus


Alignment Length:314 Identity:63/314 - (20%)
Similarity:98/314 - (31%) Gaps:120/314 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RFGHATLPPTFTP-TSSHTYPFVGLD-------------KLFPGPYMDYKSVLRPTPIRAAEHAA 174
            :.|.:.|..:.|| .||.:.|...|:             ::.|||.||                 
  Rat    18 QMGQSPLVTSRTPMQSSPSVPEQNLNWQESQGSSRESSIQMQPGPVMD----------------- 65

  Fly   175 PTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLT 239
            |..|||.:.:                   .||.|..      |...::.|....|:.        
  Rat    66 PGLPTLRSPS-------------------GHPSHQR------PSTPSSRSGFHVPIE-------- 97

  Fly   240 QQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSN 304
                      |..|.|                         ..|....|....|||...|..:|.
  Rat    98 ----------PMALSD-------------------------KYGGKQTGPVAPRKRRKERTQYSA 127

  Fly   305 LQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVP 369
            .|:..|:..|.:.:|..|....:||:.:.:|:.::||||:|.|.|.:         |:..|.|:|
  Rat   128 KQKSVLQEHFAECQYPDKKQCLELASLVRVTEKEIKVWFKNNRAKCK---------QKNVPEALP 183

  Fly   370 ESGGVFKTSTPSGD------------GTPQEALDYSSDSCSSVDLSEQADEDDN 411
            |..|..:..:.|.|            |.|........||...::.|:::..|.|
  Rat   184 EKNGGPEAVSGSTDFPGSIAVVGCDQGEPMATAILDVDSTPKLNCSQESSLDGN 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 17/52 (33%)
LOC100361016XP_008771600.2 HOX 118..174 CDD:197696 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.