DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment H2.0 and DUX4

DIOPT Version :9

Sequence 1:	NP_523488.2	Gene:	H2.0 / 33841	FlyBaseID:	FBgn0001170	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	NP_001280727.1	Gene:	DUX4 / 100288687	HGNCID:	50800	Length:	424	Species:	Homo sapiens

Alignment Length:	103	Identity:	29/103 - (28%)
Similarity:	49/103 - (47%)	Gaps:	11/103 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   285 ASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMK 349
            |.|...|:|:    |.|::..|.:.|...|::..|.....|.:||..:.:.:.:|::||||.|.:
Human    13 AEARGRGRRR----RLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQNERSR 73

  Fly   350 W--RHTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGT 385
            .  :|.||:......:.|   ||  |..|.:..:|..|
Human    74 QLRQHRRESRPWPGRRGP---PE--GRRKRTAVTGSQT 106

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
H2.0	NP_523488.2	Homeobox	298..351	CDD:278475	15/54 (28%)
DUX4	NP_001280727.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..24		4/14 (29%)
		Homeobox	27..74	CDD:306543	13/46 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	72..102		8/34 (24%)
		Homeobox	97..149	CDD:306543	3/10 (30%)
		DNA_pol3_gamma3	<141..319	CDD:331207
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	218..362
		Required for interaction with EP300 and CREBBP, and for transcriptional activation of target genes. /evidence=ECO:0000269\|PubMed:26951377	327..424
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	388..414
		Important for transcriptional activation of target genes. /evidence=ECO:0000269\|PubMed:29618456	405..424
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910