DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and hoxd8

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001135589.1 Gene:hoxd8 / 100216142 XenbaseID:XB-GENE-920113 Length:231 Species:Xenopus tropicalis


Alignment Length:299 Identity:68/299 - (22%)
Similarity:102/299 - (34%) Gaps:95/299 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SHRQSSSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDKLF 151
            |:..|...|..|...:.:...|   |:        .:..|....|..::.:.|..          
 Frog     3 SYFVSPMYPKYKDAINSAFYEC---PY--------GQEVGSGRAPLVYSGSGSGA---------- 46

  Fly   152 PGPYMDYKSVL-----RPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQ 211
            |..|..:...|     :|.|.....|..|        |.|..:.|.::||....|.:..|...  
 Frog    47 PQDYYHHPGTLPSPGYQPAPCGITCHGDP--------AKLYGYDHFQRQHIFTTHQEAEPVQY-- 101

  Fly   212 QHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTS---PAAAAAATSQNGA 273
                |...|.:||                     :|..|:.|...:|.|   |...|..      
 Frog   102 ----PDCKSPSAS---------------------IGADPEHLHQNSPASHMFPWMRAQV------ 135

  Fly   274 HGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQ 338
                           :.|:|:   .|..:|..|...||.:|....|:|:..|.:::..|.||:.|
 Frog   136 ---------------APGRRR---GRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQ 182

  Fly   339 VKVWFQNRRMKWRHTRENLK-----SGQEKQPSAVPESG 372
            ||:|||||||||:  :||.|     |.||.:..|..:.|
 Frog   183 VKIWFQNRRMKWK--KENSKDKFPVSSQEGKEEADKKGG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 23/52 (44%)
hoxd8NP_001135589.1 Homeobox 143..196 CDD:365835 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.