DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and hoxb2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_012808332.1 Gene:hoxb2 / 100038155 XenbaseID:XB-GENE-478525 Length:340 Species:Xenopus tropicalis


Alignment Length:321 Identity:84/321 - (26%)
Similarity:115/321 - (35%) Gaps:95/321 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPGPYM 156
            :|.||...|       ..|||.........|.: ....:||.|..|         :..|.||.  
 Frog    13 NSQPSLAEC-------LTSFPAVLETFQTSSIK-DSTLIPPPFEQT---------IPSLNPGS-- 58

  Fly   157 DYKSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNST 221
              .|.:||...:.||           |.||     |:.|.|..|.....|   ..:.|.....|:
 Frog    59 --DSQIRPKSQKRAE-----------NGLL-----QQPQVQPGHLATEFP---WMKEKKSAKKSS 102

  Fly   222 TASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNAS 286
            ..|                         ||.|:   |...:|..:.....|.|..|||:.:    
 Frog   103 QGS-------------------------PQALI---PPPESAGGSPAEPPGLHDAGGGSRR---- 135

  Fly   287 AGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWR 351
                       .|..::|.|...||.:|...||:.:|.|.::||.|:||:.||||||||||||.:
 Frog   136 -----------LRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHK 189

  Fly   352 HTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTP--QEALDYSSDSCSSVDLSEQADEDD 410
            ...::..|...:...:.||.|    .....||.:|  .:.|| |:||     |.||....|
 Frog   190 RQTQHKDSQDGEHSYSNPEDG----EPLDDGDDSPVYHQGLD-SNDS-----LREQEIRKD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/52 (52%)
hoxb2XP_012808332.1 Homeobox 137..190 CDD:365835 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.