DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and nkx6-2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_002937836.1 Gene:nkx6-2 / 100038084 XenbaseID:XB-GENE-484527 Length:281 Species:Xenopus tropicalis


Alignment Length:272 Identity:75/272 - (27%)
Similarity:109/272 - (40%) Gaps:72/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 VLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASA 225
            ||..||:.|..:.|....||...||                  .:|     ..|.|..:|.:|..
 Frog    16 VLSSTPLAALHNMAEMKTTLFPYAL------------------QNP-----SFKAPGLSSLSAQI 57

  Fly   226 LLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGG------------ 278
            .|...|.::.:     ..|.||.|.....::..:.|.....||| .|.:.:..            
 Frog    58 PLGTPHGISDI-----LSRPLGATLGSSANLLSSLPRINGLATS-TGMYFNPAAVSRYPKPLAEL 116

  Fly   279 ---------GNGQGN----------ASAG----SNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYI 320
                     |..||:          :.||    .:||:|.  ||..||..|...||..|:|.||:
 Frog   117 PGRAPIFWPGVMQGSPWRDPRLGCPSQAGMVLDKDGKKKH--SRPTFSGQQIFALEKTFEQTKYL 179

  Fly   321 TKPDRRKLAARLNLTDAQVKVWFQNRRMKW--RHTRENLKSGQEKQPSAVPESGGVFKTSTPSGD 383
            ..|:|.:||..|.:|::||||||||||.||  ||..| :.:.::|..|   |:..:.::|....|
 Frog   180 AGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAE-MATAKKKHDS---ETEKMKESSENEED 240

  Fly   384 GTPQEALDYSSD 395
            ....:.||.:||
 Frog   241 DEYNKPLDPNSD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 29/54 (54%)
nkx6-2XP_002937836.1 Homeobox 157..211 CDD:365835 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.