Sequence 1: | NP_523488.2 | Gene: | H2.0 / 33841 | FlyBaseID: | FBgn0001170 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001338236.1 | Gene: | DUXB / 100033411 | HGNCID: | 33345 | Length: | 345 | Species: | Homo sapiens |
Alignment Length: | 214 | Identity: | 45/214 - (21%) |
---|---|---|---|
Similarity: | 72/214 - (33%) | Gaps: | 75/214 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 ELPTKESCASTTIVSTSPTSATSTTKVKLSFSVDR-------------LLGSEPEES-------H 88
Fly 89 RQSSSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPG 153
Fly 154 PYMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRF----------------HQHQKQQHQQH--- 199
Fly 200 ------HHHQHHPKHLHQQ 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
H2.0 | NP_523488.2 | Homeobox | 298..351 | CDD:278475 | |
DUXB | NP_001338236.1 | homeodomain | 16..72 | CDD:238039 | |
homeodomain | 103..161 | CDD:238039 | 6/40 (15%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 282..314 | 9/30 (30%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |