DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and DUXB

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001338236.1 Gene:DUXB / 100033411 HGNCID:33345 Length:345 Species:Homo sapiens


Alignment Length:214 Identity:45/214 - (21%)
Similarity:72/214 - (33%) Gaps:75/214 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ELPTKESCASTTIVSTSPTSATSTTKVKLSFSVDR-------------LLGSEPEES-------H 88
            ::.|::..|..|.:..|        ::::.|...|             ||..:|.|.       |
Human   128 DIATRKKLAEQTGLQES--------RIQMWFQKQRSLYLKKSRMEPMNLLVDDPNERPDATVGWH 184

  Fly    89 RQSSSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPG 153
            ..:...|:..|             |.||.:::.|   ||.||||....|.:...||  ...:..|
Human   185 PINLFLPTDSS-------------HYFSCSHSSS---GHETLPPVLPSTQAPWDPF--RFHVSQG 231

  Fly   154 PYMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRF----------------HQHQKQQHQQH--- 199
            |.:   .:::||. ...|......|.:..|.||..                :|.:.|.|::|   
Human   232 PNV---MIMQPTQ-AVQEGEKSDQPLIIPNHLLTLPILTKDLDTPTPFWLQYQEEHQNHKEHSGS 292

  Fly   200 ------HHHQHHPKHLHQQ 212
                  .|.|..|:|..||
Human   293 GVPQVKSHSQPEPEHREQQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475
DUXBNP_001338236.1 homeodomain 16..72 CDD:238039
homeodomain 103..161 CDD:238039 6/40 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..314 9/30 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.