DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and LOC100008066

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_003199819.1 Gene:LOC100008066 / 100008066 -ID:- Length:251 Species:Danio rerio


Alignment Length:230 Identity:62/230 - (26%)
Similarity:92/230 - (40%) Gaps:70/230 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 QQHKPP--------------------PHNSTTASALLAPLHSLTSLQLTQQQQRFLGKT----PQ 251
            ::.|||                    |.:|...|..:||...|..:.| ::..|..|.:    |.
Zfish     4 EESKPPSKAHQEPIRFGIDQILGSAEPESSRLGSPNIAPHVPLPGVSL-EESGRVFGVSSALLPG 67

  Fly   252 QLLDI---APTSPAAAAAATS------QNGAH------------------GHGGGNGQGNASAGS 289
            .::.:   .|.:||..:||.:      .|...                  ||...|       .:
Zfish    68 GVIRVPAHRPLAPAMMSAAPALCFPWMDNNRRFPKDRLPALIPFTVTRRIGHPYQN-------RT 125

  Fly   290 NGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKW-RHT 353
            ..|||:  .|..||.:|...||.:|.:|||:...:|..||..|.:||||||.||||||.|| |.|
Zfish   126 PPKRKK--PRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQT 188

  Fly   354 RENLKSGQEK--------QPSAVPESGGVFKTSTP 380
            .|..::|:::        |..|:.:|.....:|.|
Zfish   189 AEEREAGRQQANRMLLQLQADALQKSISESVSSDP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 28/53 (53%)
LOC100008066XP_003199819.1 Homeobox 132..185 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.