DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and barx2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_001342044.1 Gene:barx2 / 100002200 ZFINID:ZDB-GENE-081120-4 Length:268 Species:Danio rerio


Alignment Length:208 Identity:61/208 - (29%)
Similarity:90/208 - (43%) Gaps:47/208 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 KPPPHNSTTASALLAPLHSLTSLQ-LTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHG 277
            :|.|.:|.|.|   .||.|...|. :|.|....:....|....:.|:|....:.::..:..|   
Zfish    53 RPKPLHSCTGS---VPLRSYPLLSVITHQASSSVSPLSQSSPHLPPSSETPLSISSESDTEH--- 111

  Fly   278 GGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVW 342
                     .....|:.|. ||.:|:.||..|||.:||:|||::.|||..||..|.||..|||.|
Zfish   112 ---------CTPRLKKPRR-SRTIFTELQLLGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTW 166

  Fly   343 FQNRRMKWRHTRENLKSGQE--KQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQ 405
            :|||||||:  :..||.|.|  .:|...|:     |.|.|:                     :|:
Zfish   167 YQNRRMKWK--KMVLKGGHEAPTKPKGRPK-----KNSIPT---------------------TEE 203

  Fly   406 ADEDDNIEINVVE 418
            .:..:.:|..:.|
Zfish   204 IEAQERMEAKLAE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 31/52 (60%)
barx2XP_001342044.1 Homeobox 122..175 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.