DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9098 and Crk

DIOPT Version :10

Sequence 1:NP_608979.2 Gene:CG9098 / 33840 FlyBaseID:FBgn0031762 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_651908.1 Gene:Crk / 43775 FlyBaseID:FBgn0024811 Length:271 Species:Drosophila melanogaster


Alignment Length:86 Identity:31/86 - (36%)
Similarity:50/86 - (58%) Gaps:8/86 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 HAWYHGALPRQRAEEIVQRE---GDFLVRDCASQPDNYVLSCRSKAAVLHFVLNKLVLQPETVYE 299
            ::||.|.:.||.|.|::..|   |.|||||..|...:|||..|....|.::::||:..|     :
  Fly    10 NSWYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLCVREDTKVSNYIINKVQQQ-----D 69

  Fly   300 RVQYQFEEDAFDTVPDLITFY 320
            ::.|:..:.:||.:|.|:|||
  Fly    70 QIVYRIGDQSFDNLPKLLTFY 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9098NP_608979.2 SAM_1 42..102 CDD:425739
SH2_BCAR3 233..367 CDD:198200 31/86 (36%)
RasGEF 660..>797 CDD:470590
CrkNP_651908.1 SH2_CRK_like 4..108 CDD:198180 31/86 (36%)
SH3_CRK_N 109..163 CDD:212692
SH3_CRK_C 201..257 CDD:212693
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.