DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9098 and C25A8.5

DIOPT Version :10

Sequence 1:NP_608979.2 Gene:CG9098 / 33840 FlyBaseID:FBgn0031762 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_501081.1 Gene:C25A8.5 / 182879 WormBaseID:WBGene00016085 Length:416 Species:Caenorhabditis elegans


Alignment Length:103 Identity:35/103 - (33%)
Similarity:53/103 - (51%) Gaps:16/103 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 RELRSHAWYHGALPRQRAEEIVQREGDFLVRDC---ASQPDNYVLSCRSK-----AAVLHFVLNK 289
            :::.|..||||.|||:..:.::::.||||||..   |.:|..||||....     |.|.|:|:. 
 Worm     4 KDIPSEPWYHGLLPREDIKAMLRKNGDFLVRSTEPKAGEPRQYVLSAMQSEELEDAGVKHYVMR- 67

  Fly   290 LVLQPETVYERVQYQFEEDAFDTVPDLITFYVGSGKPI 327
              |.|..     |...|...|:|:..|:.:|:.|.:||
 Worm    68 --LNPSN-----QIFLEAKGFETIASLVNYYMNSKEPI 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9098NP_608979.2 SAM_1 42..102 CDD:425739
SH2_BCAR3 233..367 CDD:198200 35/103 (34%)
RasGEF 660..>797 CDD:470590
C25A8.5NP_501081.1 SH2_Fps_family 4..98 CDD:198224 33/101 (33%)
PTKc 124..375 CDD:270623
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.