DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9098 and C55C3.4

DIOPT Version :10

Sequence 1:NP_608979.2 Gene:CG9098 / 33840 FlyBaseID:FBgn0031762 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_500846.1 Gene:C55C3.4 / 177346 WormBaseID:WBGene00016954 Length:431 Species:Caenorhabditis elegans


Alignment Length:109 Identity:29/109 - (26%)
Similarity:52/109 - (47%) Gaps:18/109 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 RELRSHAWYHGALPRQRAEEIVQREGDFLVRDCASQP-----DNYVLSC--RSKAAVLHFVLNKL 290
            ::|....:|||.|||:..:|::.:.|.||:|  .|:|     ..:|||.  ....:..|||:.: 
 Worm     4 KDLLHQKYYHGLLPREDIQEMLNKPGQFLLR--TSEPVKGEKRQFVLSVVGEKNTSANHFVVRE- 65

  Fly   291 VLQPETVYERVQYQFEEDAFDTVPDLITFYVGSGKPISSASGAL 334
              ....||      .::..|.|:.:|:..||.:.:..|:..|.:
 Worm    66 --ADHKVY------VDKIGFPTIIELVNHYVSTKESFSTKDGTV 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9098NP_608979.2 SAM_1 42..102 CDD:425739
SH2_BCAR3 233..367 CDD:198200 29/109 (27%)
RasGEF 660..>797 CDD:470590
C55C3.4NP_500846.1 SH2_Fps_family 4..93 CDD:198224 27/99 (27%)
TyrKc 121..376 CDD:197581
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.