DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9098 and C35E7.10

DIOPT Version :10

Sequence 1:NP_608979.2 Gene:CG9098 / 33840 FlyBaseID:FBgn0031762 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_492826.1 Gene:C35E7.10 / 172988 WormBaseID:WBGene00016462 Length:430 Species:Caenorhabditis elegans


Alignment Length:109 Identity:30/109 - (27%)
Similarity:53/109 - (48%) Gaps:18/109 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 RELRSHAWYHGALPRQRAEEIVQREGDFLVRDCASQP-----DNYVLSC--RSKAAVLHFVLNKL 290
            ::|....:|||.|||:..:|::.:.|.||:|  .|:|     ..:|||.  ..|.:..|||:.: 
 Worm     4 KDLLHQKYYHGLLPREDIQEMLNKPGQFLLR--TSEPVKGEKRQFVLSVVGEKKTSANHFVVRE- 65

  Fly   291 VLQPETVYERVQYQFEEDAFDTVPDLITFYVGSGKPISSASGAL 334
              ....||      .::..|.|:.:|:..||.:.:..|:..|.:
 Worm    66 --SDHKVY------VDKIGFPTIIELVNHYVSTKESFSTKDGTV 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9098NP_608979.2 SAM_1 42..102 CDD:425739
SH2_BCAR3 233..367 CDD:198200 30/109 (28%)
RasGEF 660..>797 CDD:470590
C35E7.10NP_492826.1 SH2_Fps_family 4..93 CDD:198224 28/99 (28%)
TyrKc 121..376 CDD:197581
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.