DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ICAM2 and sc:d0202

DIOPT Version :9

Sequence 1:NP_000864.2 Gene:ICAM2 / 3384 HGNCID:5345 Length:275 Species:Homo sapiens
Sequence 2:NP_001091722.2 Gene:sc:d0202 / 569842 ZFINID:ZDB-GENE-080226-9 Length:292 Species:Danio rerio


Alignment Length:231 Identity:55/231 - (23%)
Similarity:89/231 - (38%) Gaps:38/231 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    15 TLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCN------QPEVGGLETSLDKIL---LD 70
            ||..||        :.:.|:.:.|:...|:.||||::..      :..|||:..|...::   :.
Zfish    23 TLAECP--------LPISPQSVVVKFGDSVSVNCSSSVTHMGMGWESTVGGVHLSTASLITWRVS 79

Human    71 EQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQV-ILTLQPTLVAVGKSFTIEC 134
            |...|..|...         |:.....:|..:...|:||:.|..| |.|:..|::. |..:.:.|
Zfish    80 ELTDWDIYTPF---------CYINYDKQQCVVALPVTVYKTPDSVSISTVNLTMIE-GNLYELLC 134

Human   135 RVPTVEPLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSR 199
            .|..|.|:..||:..::|...:....|.....:|...|:......||.|....:.|.|.|:|...
Zfish   135 DVHNVAPVQKLTVNWYKGETLVDQTNFTDTTKSPVNKTSKLLIRPDRADDGAQYRCEAELNLGDE 199

Human   200 G----GNIFHK------HSAPKMLEIYEPVSDSQMV 225
            |    ..:..|      |..||.....|.:|.|..|
Zfish   200 GPQHPPTVTSKSFSIKVHYKPKHSRSTEKISQSDDV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ICAM2NP_000864.2 ICAM_N 24..109 CDD:252248 17/93 (18%)
Ig2_ICAM-1_like 112..211 CDD:143232 26/109 (24%)
Required for interaction with EZR, MSN and RDX and co-localization to microvilli. /evidence=ECO:0000250|UniProtKB:P35330 251..275
sc:d0202NP_001091722.2 Ig 112..211 CDD:325142 24/99 (24%)
Ig_2 219..292 CDD:316418 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AT49
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D241566at7742
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.