DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ICAM2 and tutl

DIOPT Version :9

Sequence 1:	NP_000864.2	Gene:	ICAM2 / 3384	HGNCID:	5345	Length:	275	Species:	Homo sapiens
Sequence 2:	NP_001303307.1	Gene:	tutl / 46015	FlyBaseID:	FBgn0010473	Length:	1536	Species:	Drosophila melanogaster

Alignment Length:	124	Identity:	27/124 - (21%)
Similarity:	44/124 - (35%)	Gaps:	40/124 - (32%)

- Green bases have known domain annotations that are detailed below.

Human    80 VSNISHDTVL------------------QCHFTCSGKQESMNSN-----VSVYQPPRQVILTLQP 121
            ||.:|.|:..                  :|......:....:.|     :.|:.|||..:.....
  Fly   198 VSRVSQDSPFGSASLNLTNIRESDQGWYECKVVFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDI 262

Human   122 TLVAVGKSFTIECR---VPTVE--------PLD-SLTLFLFR-GNE----TLHYETFGK 163
            ..|.:|.|..:.|:   .||.|        |:| |.|:.:|. |.|    |:.:|..|:
  Fly   263 IYVNLGDSIILNCQADGTPTPEILWYKDANPVDPSPTVGIFNDGTELRISTIRHEDIGE 321

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ICAM2	NP_000864.2	ICAM_N	24..109	CDD:252248	6/51 (12%)
		Ig2_ICAM-1_like	112..211	CDD:143232	19/69 (28%)
		Required for interaction with EZR, MSN and RDX and co-localization to microvilli. /evidence=ECO:0000250\|UniProtKB:P35330	251..275
tutl	NP_001303307.1	V-set	137..250	CDD:284989	6/51 (12%)
		IG_like	137..229	CDD:214653	5/30 (17%)
		I-set	253..341	CDD:254352	19/69 (28%)
		IGc2	268..331	CDD:197706	16/54 (30%)
		I-set	346..437	CDD:254352
		Ig	349..437	CDD:299845
		Ig	459..530	CDD:299845
		IG_like	549..628	CDD:214653
		IGc2	551..617	CDD:197706
		FN3	633..725	CDD:238020
		FN3	786..874	CDD:238020
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910