DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ICAM2 and nrm

DIOPT Version :9

Sequence 1:NP_000864.2 Gene:ICAM2 / 3384 HGNCID:5345 Length:275 Species:Homo sapiens
Sequence 2:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster


Alignment Length:260 Identity:53/260 - (20%)
Similarity:95/260 - (36%) Gaps:89/260 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    20 PGSDEKVFEVHVRPKKLAVE-------PKGSLEVNCSTTCNQPEVGGLETSLDKILLDEQAQW-- 75
            |.|::|...||..|...|:.       .|.|:..:||.  :.|   |...|       .:.:|  
  Fly   567 PRSEDKELLVHYEPGPAALSHFPLVAVKKKSVTFSCSV--DDP---GFPES-------NRFRWLR 619

Human    76 -----------KHYLVSNISHDTVLQCHFTC-----SGKQESMNSNVSVYQPPRQVILTLQP--T 122
                       |.:.|..:..|:  :.:::|     .||......|:.|:.|| ..|..|.|  .
  Fly   620 GGRGPLQDIVTKDWTVEPVGLDS--RTNYSCYAYNEGGKGVMATVNLEVHAPP-FFIKNLPPYTG 681

Human   123 LVAVGKSFTIECRVPTVE-----------PLDSLTLFLFRGNETLHY--ETFGKAAPA------- 167
            ::....:.|:.||:..|.           |::.        |::.::  |.:..|:||       
  Fly   682 ILHSSPNATLTCRIECVPRCDISWQKDGVPIER--------NDSRYFIKEKYMDASPATGDFESM 738

Human   168 --------PQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNI-----FHKHSAPKMLEIYEPV 219
                    |....:.||..||    :.|:||::..:::  ||:|     |....||:...:.|.:
  Fly   739 LSVLHFNMPNWPDSKFNIEAD----NANYSCVSTGNIV--GGSIRSRTYFGIEYAPENTTVSENI 797

Human   220  219
              Fly   798  797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ICAM2NP_000864.2 ICAM_N 24..109 CDD:252248 20/109 (18%)
Ig2_ICAM-1_like 112..211 CDD:143232 27/133 (20%)
Required for interaction with EZR, MSN and RDX and co-localization to microvilli. /evidence=ECO:0000250|UniProtKB:P35330 251..275
nrmNP_001246890.1 Ig 44..152 CDD:299845
Ig 176..248 CDD:299845
Ig 277..354 CDD:299845
IG_like 383..463 CDD:214653
Ig 394..463 CDD:143165
Ig_3 585..652 CDD:290638 12/80 (15%)
Ig 685..>719 CDD:299845 6/41 (15%)
IG_like 788..869 CDD:214653 2/10 (20%)
Ig <811..869 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.