DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33932 and TMEM203

DIOPT Version :9

Sequence 1:NP_001027079.1 Gene:CG33932 / 338392 FlyBaseID:FBgn0066303 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_444273.1 Gene:TMEM203 / 94107 HGNCID:28217 Length:136 Species:Homo sapiens


Alignment Length:146 Identity:58/146 - (39%)
Similarity:86/146 - (58%) Gaps:14/146 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLSELVRWLGLTEFEILVNLCGLLVFTITLTVKLHLQARAGPGGILPEPMG-DWFTVFSPLFF 64
            :|.|.|||:|||...|||.|:|..||||::.|.:::        .|::|   | .|:.||.|.|.
Human     2 LFSLRELVQWLGFATFEIFVHLLALLVFSVLLALRV--------DGLVP---GLSWWNVFVPFFA 55

  Fly    65 IDICNAYFCVIVGIRMYLDSNNKRKALHRFMWSTYFLVLIAIFKYLLCLKLSSKT-GLEYSEVFS 128
            .|..:.||..||.:|::.| ..||.|:.|..|....|.|..:|:.|||.||:.:| .|.:..:.|
Human    56 ADGLSTYFTTIVSVRLFQD-GEKRLAVLRLFWVLTVLSLKFVFEMLLCQKLAEQTRELWFGLITS 119

  Fly   129 PIFVLLQLVAVRACQL 144
            |:|:||||:.:|||::
Human   120 PLFILLQLLMIRACRV 135



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154190
Domainoid 1 1.000 56 1.000 Domainoid score I11109
eggNOG 1 0.900 - - E1_KOG3631
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48984
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007492
OrthoInspector 1 1.000 - - oto88818
orthoMCL 1 0.900 - - OOG6_109645
Panther 1 1.100 - - LDO PTHR13568
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5244
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.