powered by:
Protein Alignment CG33932 and Parvg
DIOPT Version :9
Sequence 1: | NP_001027079.1 |
Gene: | CG33932 / 338392 |
FlyBaseID: | FBgn0066303 |
Length: | 148 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001155972.1 |
Gene: | Parvg / 64099 |
MGIID: | 2158329 |
Length: | 384 |
Species: | Mus musculus |
Alignment Length: | 63 |
Identity: | 16/63 - (25%) |
Similarity: | 24/63 - (38%) |
Gaps: | 24/63 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 GIRMYLDSNNKR--------KALHRFMWSTYF----------------LVLIAIFKYLLCLKL 115
|.:.||..|:|| |.|..::.:|.. |:|..:|:.|..|||
Mouse 81 GKKKYLSPNSKRNPKFEELQKVLMEWINTTLLPEHIVVRSLEEDMFDGLILHHLFQKLASLKL 143
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33932 | NP_001027079.1 |
None |
Parvg | NP_001155972.1 |
CH |
98..199 |
CDD:278723 |
10/46 (22%) |
CH |
265..365 |
CDD:278723 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3631 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.