| Sequence 1: | NP_001027079.1 | Gene: | CG33932 / 338392 | FlyBaseID: | FBgn0066303 | Length: | 148 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_060692.3 | Gene: | PARVA / 55742 | HGNCID: | 14652 | Length: | 372 | Species: | Homo sapiens |
| Alignment Length: | 40 | Identity: | 11/40 - (27%) |
|---|---|---|---|
| Similarity: | 19/40 - (47%) | Gaps: | 9/40 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 103 LIAIFKYLLCLKLSSKTGLEY--SEVFSPIFVLLQLVAVR 140 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG33932 | NP_001027079.1 | TMEM203 | 2..144 | CDD:439364 | 11/40 (28%) |
| PARVA | NP_060692.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..45 | ||
| Interaction with ARHGAP31. /evidence=ECO:0000269|PubMed:16860736 | 21..25 | ||||
| CH_PARVA_rpt1 | 91..205 | CDD:409184 | 6/24 (25%) | ||
| Required for interaction with TESK1 and ILK. /evidence=ECO:0000269|PubMed:15817463 | 223..372 | ||||
| CH_PARVA_rpt2 | 244..372 | CDD:409186 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||