DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33932 and tmem203

DIOPT Version :9

Sequence 1:NP_001027079.1 Gene:CG33932 / 338392 FlyBaseID:FBgn0066303 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001011060.1 Gene:tmem203 / 496470 XenbaseID:XB-GENE-6454036 Length:136 Species:Xenopus tropicalis


Alignment Length:145 Identity:54/145 - (37%)
Similarity:83/145 - (57%) Gaps:12/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLSELVRWLGLTEFEILVNLCGLLVFTITLTVKLHLQARAGPGGILPEPMGDWFTVFSPLFFI 65
            :|.|.|||:|||..:.||.:::..|||||:.|.:|        ..|..|:.  .|:.:|.|.|..
 Frog     2 LFSLLELVQWLGFAQLEIFLHIWALLVFTVLLALK--------ADGFAPDM--SWWNIFIPFFTA 56

  Fly    66 DICNAYFCVIVGIRMYLDSNNKRKALHRFMWSTYFLVLIAIFKYLLCLKLSSKT-GLEYSEVFSP 129
            |..:.||..||.:|::.| ..||:|:.|..|....|.|..:|:.|||.||..:: .|.:..:.||
 Frog    57 DGLSTYFTTIVTVRLFQD-GEKRQAVLRLFWILTILSLKFVFEMLLCQKLVEQSRELWFGLIMSP 120

  Fly   130 IFVLLQLVAVRACQL 144
            :|:||||:.:|||::
 Frog   121 VFILLQLLMIRACRV 135



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11147
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I4917
OMA 1 1.010 - - QHG48984
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007492
OrthoInspector 1 1.000 - - oto102693
Panther 1 1.100 - - LDO PTHR13568
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5244
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.