DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33932 and tmem203

DIOPT Version :9

Sequence 1:NP_001027079.1 Gene:CG33932 / 338392 FlyBaseID:FBgn0066303 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001002519.1 Gene:tmem203 / 436792 ZFINID:ZDB-GENE-040718-225 Length:140 Species:Danio rerio


Alignment Length:154 Identity:57/154 - (37%)
Similarity:82/154 - (53%) Gaps:26/154 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLSELVRWLGLTEFEILVNLCGLLVFTITLTVKLHLQARAGPGGILPEPMGD-------WFTV 58
            :|.|.|||:|||...||:.::|..||||::  .|.||:..             |       |:.|
Zfish     2 LFSLRELVQWLGFATFELFLHLGALLVFSV--LVALHMDV-------------DKQTLEMSWWLV 51

  Fly    59 FSPLFFIDICNAYFCVIVGIRMYLDSNNKRKALHRFMWSTYFLVLIAIFKYLLCLKLSSK---TG 120
            |||||..|..:.||..||.||:| ....||.|:.|.:|....|.|..:.:.|||.||:.:   ..
Zfish    52 FSPLFTADGLSTYFTAIVSIRLY-QEGEKRLAVLRLLWVLTVLSLKLVCEVLLCQKLAEQERAQD 115

  Fly   121 LEYSEVFSPIFVLLQLVAVRACQL 144
            |.:..:.||:|:||||:.:|||::
Zfish   116 LWFGLIVSPLFILLQLLMIRACRV 139



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589391
Domainoid 1 1.000 55 1.000 Domainoid score I11179
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5097
OMA 1 1.010 - - QHG48984
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007492
OrthoInspector 1 1.000 - - oto39892
orthoMCL 1 0.900 - - OOG6_109645
Panther 1 1.100 - - LDO PTHR13568
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5244
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.