DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33932 and CG13919

DIOPT Version :9

Sequence 1:NP_001027079.1 Gene:CG33932 / 338392 FlyBaseID:FBgn0066303 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_647637.1 Gene:CG13919 / 38200 FlyBaseID:FBgn0035248 Length:131 Species:Drosophila melanogaster


Alignment Length:110 Identity:26/110 - (23%)
Similarity:48/110 - (43%) Gaps:11/110 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LLVFTITLTVKLHLQARAGPGGILPEPMGDWFTVFSPLFFIDICNAYFCVIVGIRMYLDSNNKRK 89
            :|||.|.|.::|.           |....:||..|:||:|.|:....:.:|..||.:.:......
  Fly    14 VLVFLILLCLRLD-----------PRTTWNWFVTFTPLWFFDVIIIIYVIIKFIRKWRNLTCLTD 67

  Fly    90 ALHRFMWSTYFLVLIAIFKYLLCLKLSSKTGLEYSEVFSPIFVLL 134
            .|..:.|:...::|....:.::||.|.....:......:|:.:||
  Fly    68 LLFLYKWNIAGVLLTIASQVMICLTLEYPQQIPIYVTVAPVILLL 112



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13568
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.