DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33932 and CG14194

DIOPT Version :10

Sequence 1:NP_001027079.1 Gene:CG33932 / 338392 FlyBaseID:FBgn0066303 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_573360.1 Gene:CG14194 / 32908 FlyBaseID:FBgn0030996 Length:358 Species:Drosophila melanogaster


Alignment Length:95 Identity:25/95 - (26%)
Similarity:46/95 - (48%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DWFTVFSPLFFIDIC--------NAYFCVIVGIRMYLDSNNKRKALHRFMWSTYFLVLIAIFKYL 110
            :|..||.|::.: ||        |..||.|:.....:....|:.||:..:.:...::.:..|:.:
  Fly   167 NWDVVFVPMWIV-ICLSLVSVLYNIIFCGIMMRTPEVSLQQKKAALNAAVGNICTVLPLLCFQVV 230

  Fly   111 LCLKLSSKTGLEYSEVFSPIFV-LLQLVAV 139
            :|.||..:....|..||||:.| :|.|:.:
  Fly   231 ICDKLDGELKFPYIVVFSPLLVSILALIVL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33932NP_001027079.1 TMEM203 2..144 CDD:439364 25/95 (26%)
CG14194NP_573360.1 Tmemb_185A 30..253 CDD:402059 22/86 (26%)

Return to query results.
Submit another query.