DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33932 and CG14194

DIOPT Version :9

Sequence 1:NP_001027079.1 Gene:CG33932 / 338392 FlyBaseID:FBgn0066303 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_573360.1 Gene:CG14194 / 32908 FlyBaseID:FBgn0030996 Length:358 Species:Drosophila melanogaster


Alignment Length:95 Identity:25/95 - (26%)
Similarity:46/95 - (48%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DWFTVFSPLFFIDIC--------NAYFCVIVGIRMYLDSNNKRKALHRFMWSTYFLVLIAIFKYL 110
            :|..||.|::.: ||        |..||.|:.....:....|:.||:..:.:...::.:..|:.:
  Fly   167 NWDVVFVPMWIV-ICLSLVSVLYNIIFCGIMMRTPEVSLQQKKAALNAAVGNICTVLPLLCFQVV 230

  Fly   111 LCLKLSSKTGLEYSEVFSPIFV-LLQLVAV 139
            :|.||..:....|..||||:.| :|.|:.:
  Fly   231 ICDKLDGELKFPYIVVFSPLLVSILALIVL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33932NP_001027079.1 None
CG14194NP_573360.1 Tmemb_185A 30..253 CDD:287271 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13568
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.